C6orf94 Rabbit Polyclonal Antibody

• Catalog Number: orb325651
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZC2HC1B
• Target: ZC2HC1B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Guinea pig, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf94
• Protein Sequence: Synthetic peptide located within the following region: PICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSKSPPVRKSNWRQQHE
• UniProt ID: Q5TFG8
• MW: 25kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FAM164B antibody, anti dJ468K18.5 antibody, a
• Research Area: Cancer Biology, Cell Biology, Epigenetics & Chroma
• Note: For research use only
• NCBI: NP_001013645

WB Suggested Anti-C6orf94 Antibody Titration: 0.125 ug/mL, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.