C6orf94 Rabbit Polyclonal Antibody

SKU: orb325651

Description

Rabbit polyclonal antibody to ZC2HC1B

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Guinea pig, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf94
• Target: ZC2HC1B
• Protein Sequence: Synthetic peptide located within the following region: PICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSKSPPVRKSNWRQQHE
• Molecular Weight: 25kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FAM164B antibody, anti dJ468K18.5 antibody, anti C6orf94 antibody

WB Suggested Anti-C6orf94 Antibody Titration: 0.125 ug/mL, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.

Quick Database Links

Gene Symbol

ZC2HC1B

UniProt

Q5TFG8

RefSeq (Protein):NP_001013645