ZBTB7C Rabbit Polyclonal Antibody

• Catalog Number: orb574424
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZBTB7C
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB7C
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 69kDa
• Target: ZBTB7C
• UniProt ID: O73453
• Protein Sequence: Synthetic peptide located within the following region: MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRS
• NCBI: NP_001034449
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: APM1, APM-1, ZBTB36, ZNF857C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-ZBTB7C Antibody Titration: 5.0 ug/ml, Positive Control: Raji cell lysate, ZBTB7C is supported by BioGPS gene expression data to be expressed in Raji.