ZBTB38 Rabbit Polyclonal Antibody

• Catalog Number: orb330093
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZBTB38
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB38
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 131kDa
• Target: ZBTB38
• UniProt ID: Q8NAP3
• Protein Sequence: Synthetic peptide located within the following region: MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNV
• NCBI: XP_001133510
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CIBZ antibody, anti ZNF921 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/mL.

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 3 ug/mL.

Human kidney

WB Suggested Anti-ZBTB38 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.