Zbtb37 Rabbit Polyclonal Antibody

SKU: orb324358

Description

Zbtb37 Rabbit Polyclonal Antibody is an unconjugated, affinity-purified antibody targeting Zbtb37. It is suitable for WB and is reactive with mouse samples. Predicted reactivity includes bovine, canine, equine, guinea pig, human, rabbit, and rat. This antibody is supplied as a liquid in 1× PBS with 0.09% sodium azide and 2% sucrose.

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Zbtb37
• Protein Sequence: Synthetic peptide located within the following region: NLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTLGSSGAKV
• Molecular Weight: 56kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti D430004I08Rik antibody

Quick Database Links

Gene Symbol

Zbtb37

UniProt

Q8C3U9

RefSeq (Protein):NP_775600