ZBTB20 Rabbit Polyclonal Antibody

• Catalog Number: orb324390
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZBTB20
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZBTB20
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 81 kDa
• Target: ZBTB20
• UniProt ID: Q9HC78
• Protein Sequence: Synthetic peptide located within the following region: SNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQ
• NCBI: NP_056457
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HOF antibody, anti DPZF antibody, anti ODA-8S
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Positive control (+): 293T (2T), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/mL.

WB Suggested Anti-ZBTB20 Antibody Titration: 2.0 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.