ZBTB12 Rabbit Polyclonal Antibody

• Catalog Number: orb577412
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZBTB12
• Target: ZBTB12
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB12
• Protein Sequence: Synthetic peptide located within the following region: MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVI
• UniProt ID: Q9Y330
• MW: 49kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: G10, Bat9, NG35, D6S59E, C6orf46
• Note: For research use only
• NCBI: NP_862825

WB Suggested Anti-ZBTB12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: PANC1 cell lysate.