Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

YWHAQ Rabbit Polyclonal Antibody

SKU: orb592682

Description

YWHAQ Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of YWHAQ. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human YWHAQ. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Guinea pig, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Guinea pig, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human YWHAQ
TargetYWHAQ
Protein SequenceSynthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC
Molecular Weight28kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

1C5, HS1, 14-3-3

Similar Products

  • 14-3-3 θ/τ rabbit pAb Antibody [orb764420]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • YWHAQ Rabbit Polyclonal Antibody [orb624373]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • 14-3-3 Tau Rabbit Polyclonal Antibody [orb155527]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • YWHAQ Rabbit Polyclonal Antibody [orb2955319]

    ELISA,  IHC,  WB

    Bovine, Gallus, Human, Mouse, Rabbit, Rat, Xenopus

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • 14-3-3-pan (Acetyl Lys51/49) rabbit pAb Antibody [orb771306]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006817

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry