YRDC Rabbit Polyclonal Antibody

• Catalog Number: orb326548
• Category: Antibodies
• Description: Rabbit polyclonal antibody to YRDC
• Target: YRDC
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human YRDC
• Protein Sequence: Synthetic peptide located within the following region: VPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQ
• UniProt ID: Q86U90
• MW: 24kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti DRIP3 antibody, anti FLJ23476 antibody, anti
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_078916

Rabbit Anti-YRDC antibody, Formalin Fixed Paraffin Embedded Tissue: Human Thymus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-YRDC Antibody, Titration: 1.0 ug/mL, Positive Control: ACHN Whole Cell.