Yod1 Rabbit Polyclonal Antibody

• Catalog Number: orb586913
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Yod1
• Target: Yod1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Yod1
• Protein Sequence: Synthetic peptide located within the following region: VPQSEAGTKAGPAGGRPADTMWRVRCKAKGGTHLLQGLSSRTRLRELQGQ
• UniProt ID: Q8CB27
• MW: 38 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Hshin7, 6330564D18Rik, 9930028C20Rik
• Research Area: Cell Biology, Protein Biochemistry
• Note: For research use only
• NCBI: NP_848806

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Type: Mouse Spleen lysates, Antibody dilution: 1.0 ug/ml.