You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb371701 |
---|---|
Category | Antibodies |
Description | YAP1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human YAP1 (62-97aa ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 54462 MW |
UniProt ID | P46937 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Transcriptional coactivator YAP1;Yes-associated pr Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of HepG2 cells using anti-YAP1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of YAP1 using anti-YAP1 antibody.Lane 1:human HeLa cell; 2:human HepG2 cell; 3:human THP-1 cell; 4:human SW620 cell; 5:rat liver tissue; 6:rat PC-12 cell; 7:mouse liver tissue; 8:mouse ANA-1 cell.
IF analysis of YAP1 using anti-YAP1 antibody. YAP1 was detected in immunocytochemical section of SK-OV-3 cells.
IF analysis of YAP1 using anti-YAP1 antibody. YAP1 was detected in an immunocytochemical section of U20S cells.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
Filter by Rating