YAP1 Antibody

• Catalog Number: orb371701
• Category: Antibodies
• Description: YAP1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human YAP1 (62-97aa ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 54462 MW
• UniProt ID: P46937
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Transcriptional coactivator YAP1;Yes-associated pr
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HepG2 cells using anti-YAP1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of YAP1 using anti-YAP1 antibody.Lane 1:human HeLa cell; 2:human HepG2 cell; 3:human THP-1 cell; 4:human SW620 cell; 5:rat liver tissue; 6:rat PC-12 cell; 7:mouse liver tissue; 8:mouse ANA-1 cell.

IF analysis of YAP1 using anti-YAP1 antibody. YAP1 was detected in immunocytochemical section of SK-OV-3 cells.

IF analysis of YAP1 using anti-YAP1 antibody. YAP1 was detected in an immunocytochemical section of U20S cells.