Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

G22P1 Rabbit Polyclonal Antibody

SKU: orb324513

Description

G22P1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of XRCC6. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human G22P1. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityCanine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human G22P1
TargetXRCC6
Protein SequenceSynthetic peptide located within the following region: NFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVL
Molecular Weight70kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ML8 antibody, anti KU70 antibody, anti TLAA antibody, anti CTC75 antibody, anti CTCBF antibody, anti G22P1 antibody

Similar Products

  • Ku70/XRCC6 Rabbit Polyclonal Antibody [orb308815]

    FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • XRCC6 Antibody (C-term) [orb1430573]

    FC,  IF,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Ku-70 rabbit pAb Antibody [orb765556]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Ku-70 (Acetyl Lys542) rabbit pAb Antibody [orb763983]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • XRCC6 Antibody (Center) [orb1930673]

    FC,  IF,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

G22P1 Rabbit Polyclonal Antibody

Human kidney

G22P1 Rabbit Polyclonal Antibody

Human Liver

G22P1 Rabbit Polyclonal Antibody

Rabbit Anti-XRCC6 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

G22P1 Rabbit Polyclonal Antibody

WB Suggested Anti-G22P1 Antibody Titration: 0.6 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, XRCC6 is supported by BioGPS gene expression data to be expressed in HepG2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001460

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

G22P1 Rabbit Polyclonal Antibody (orb324513)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry