XRCC5 Rabbit Polyclonal Antibody

SKU: orb574940

Description

Rabbit polyclonal antibody to XRCC5

Research Area

Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC-P, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human XRCC5
• Target: XRCC5
• Protein Sequence: Synthetic peptide located within the following region: GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM
• Molecular Weight: 83kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

KU80, KUB2, Ku86, NFIV, KARP1, KARP-1

Human Pancreas

Lanes: 1. 30 ug MiaPaca-2 cell lysate, 2. 30 ug Panc-1 cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody dilution: 1:4000, Gene Name: XRCC5.

Sample Type: Human lung adenocarcinoma cell line A549, Primary Antibody dilution: 1:100, Secondary Antibody: Goat anti-rabbit AlexaFluor 488, Secondary Antibody dilution: 1:400, Color/Signal Descriptions: XRCC5: Green DAPI:Blue, Gene Name: XRCC5.

WB Suggested Anti-XRCC5 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:12500, Positive Control: Jurkat cell lysate, XRCC5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

XRCC5

UniProt

Q4VBQ5

RefSeq (Protein):NP_066964