WNT9B Rabbit Polyclonal Antibody

SKU: orb577970

Description

WNT9B Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of WNT9B. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human WNT9B. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human WNT9B
• Target: WNT9B
• Protein Sequence: Synthetic peptide located within the following region: FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD
• Molecular Weight: 39kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

WNT15, WNT14B

Quick Database Links

Gene Symbol

WNT9B

UniProt

O14905

RefSeq (Protein):NP_003387