WDR63 Rabbit Polyclonal Antibody

SKU: orb581838

Description

WDR63 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of WDR63. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human WDR63. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR63
• Target: WDR63
• Protein Sequence: Synthetic peptide located within the following region: EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK
• Molecular Weight: 103kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DIC3, WDR63, NYD-SP29

Quick Database Links

Gene Symbol

WDR63

UniProt

Q8IWG1

RefSeq (Protein):NP_660155