WDR33 Rabbit Polyclonal Antibody

SKU: orb325163

Description

Rabbit polyclonal antibody to WDR33

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR33
• Target: WDR33
• Protein Sequence: Synthetic peptide located within the following region: TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL
• Molecular Weight: 30kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ11294 antibody, anti WDC146 antibody, anti NET14 antibody

Sample Type: Human HepG2, Antibody Dilution: 1.0 ug/mL, WDR33 is supported by BioGPS gene expression data to be expressed in HepG2.

Lanes: 1: SREC pulldown from lysate from 10^6 human 293T cells, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-Alexa Fluor, Secondary Antibody Dilution: 1:5000, Gene Name: WDR33.

WB Suggested Anti-WDR33 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, WDR33 is supported by BioGPS gene expression data to be expressed in HepG2.

Quick Database Links

Gene Symbol

WDR33

UniProt

Q6NUQ0

RefSeq (Protein):NP_001006624