You have no items in your shopping cart.
Cart summary
Item 1 of 1
WDR26 Rabbit Polyclonal Antibody
Catalog Number: orb585378
| Catalog Number | orb585378 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to WDR26 |
| Target | WDR26 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of mouse WDR26 |
| Protein Sequence | Synthetic peptide located within the following region: TERIHVLSGYLMCSHAEDLRAKAEWEGKGTASRSKLLDKLQTYLPPSVML |
| UniProt ID | Q9H7D7 |
| MW | 56kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CDW2, GID7, MIP2, SKDEAS |
| Note | For research use only |
| NCBI | NP_001108585.2 |
Sample Type: Mouse Spleen lysates, Antibody dilution: 1.0 ug/ml.
- Item 1 of 6
WDR26 Rabbit Polyclonal Antibody [orb11572]
FC, ICC, IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Gallus
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 1
- Item 1 of 1
