VSX1 Rabbit Polyclonal Antibody

• Catalog Number: orb575682
• Category: Antibodies
• Description: Rabbit polyclonal antibody to VSX1
• Target: VSX1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VSX1
• Protein Sequence: Synthetic peptide located within the following region: LAGLWGSDHFKEGSSQSESGSQRGSDKVSPENGLEDVAIDLSSSARQETK
• UniProt ID: Q9NZR4
• MW: 38kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PPD, KTCN, PPCD, RINX, KTCN1, PPCD1, CAASDS
• Research Area: Epigenetics & Chromatin, Stem Cell & Developmental
• Note: For research use only
• NCBI: NP_055403

Sample Type: Human 293T, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human 721_B, Antibody Dilution: 1.0 ug/ml. VSX1 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-VSX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.