You have no items in your shopping cart.
Cart summary
VPREB1 Protein, Human, Recombinant (His & SUMO)
Catalog Number: orb1978392
| Catalog Number | orb1978392 |
|---|---|
| Category | Proteins |
| Description | Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| Protein Sequence | QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP |
| UniProt ID | P12018 |
| MW | 30.5 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation. |
| Expression Region | 20-145 aa |
| Storage | -20°C |
| Note | For research use only |
