You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Viral Polymerase acidic protein
Catalog Number: orb419359
| Catalog Number | orb419359 |
|---|---|
| Category | Proteins |
| Description | Recombinant Influenza A virus Polymerase acidic |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 18.6 kDa |
| UniProt ID | Q9IQ47 |
| Protein Sequence | RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Influenza A virus (strain A/x-31 H3N2) |
| Expression Region | 124-247aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | RNA-directed RNA polymerase subunit P2 Read more... |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 6xHis-taggedExpression Region: 124-247aaSequence Info: Full Length |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/x-31 H3N2) PA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/x-31 H3N2) PA.
