You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Viral Nucleoprotein protein
Catalog Number: orb419345
| Catalog Number | orb419345 |
|---|---|
| Category | Proteins |
| Description | Recombinant Zaire ebolavirus Nucleo |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 31.1 kDa |
| UniProt ID | P18272 |
| Protein Sequence | LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ |
| Protein Length | Partial |
| Source | Yeast |
| Biological Origin | Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) |
| Expression Region | 488-739aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Nucleocapsid protein Read more... |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 6xHis-taggedExpression Region: 488-739aaSequence Info: Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) NP.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) NP.
- Item 1 of 3
Viral Nucleoprotein protein [orb419355]
Greater than 90% as determined by SDS-PAGE.
53.3 kDa
E.coli
1 mg, 20 μg, 100 μg - Item 1 of 3
Viral Nucleoprotein protein [orb358797]
Greater than 90% as determined by SDS-PAGE.
65 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 3
Viral Nucleoprotein protein [orb358624]
Greater than 90% as determined by SDS-PAGE.
43.4 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
Viral Nucleoprotein protein [orb383101]
Greater than 90% as determined by SDS-PAGE.
72.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
Viral Nucleoprotein protein [orb383102]
Greater than 90% as determined by SDS-PAGE.
72 kDa
E.coli
20 μg, 100 μg, 1 mg
