You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291973 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant VIPR2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | VIPR2 (NP_003373, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILV |
Tested applications | ELISA, WB |
Clone Number | 2E3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003373 |
VIPR2 monoclonal antibody (M01), clone 2E3. Western Blot analysis of VIPR2 expression in IMR-32.
Western Blot detection against Immunogen (37.07 KDa).