Vaccinia virus (strain Western Reserve) K3 Protein (His)

• Catalog Number: orb1976250
• Category: Proteins
• Description: Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Vaccinia virus (strain Western Reserve) K3 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.6 kDa and the accession number is P18378.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 12.6 kDa (predicted)
• UniProt ID: P18378
• Protein Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
• Expression System: P. pastoris (Yeast)
• Biological Origin: VACV
• Biological Activity: Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Vaccinia virus (strain Western Reserve) K3 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.6 kDa and the accession number is P18378.
• Expression Region: 1-88 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.