You have no items in your shopping cart.
Cart summary
Vaccinia virus (strain Western Reserve) K3 Protein (His & SUMO)
Catalog Number: orb1976249
| Catalog Number | orb1976249 |
|---|---|
| Category | Proteins |
| Description | Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Vaccinia virus (strain Western Reserve) K3 Protein (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 26.6 kDa and the accession number is P18378. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 26.6 kDa (predicted) |
| UniProt ID | P18378 |
| Protein Sequence | MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ |
| Expression System | E. coli |
| Biological Origin | VACV |
| Biological Activity | Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff. Vaccinia virus (strain Western Reserve) K3 Protein (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 26.6 kDa and the accession number is P18378. |
| Expression Region | 1-88 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
