Vaccinia virus (strain Western Reserve) L1 Protein (His)

• Catalog Number: orb1976245
• Category: Proteins
• Description: Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Vaccinia virus (strain Western Reserve) L1 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.3 kDa and the accession number is P07612.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 21.3 kDa (predicted)
• UniProt ID: P07612
• Protein Sequence: GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG
• Expression System: P. pastoris (Yeast)
• Biological Origin: VACV
• Biological Activity: Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Vaccinia virus (strain Western Reserve) L1 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 21.3 kDa and the accession number is P07612.
• Expression Region: 2-183 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.