You have no items in your shopping cart.
Cart summary
Vaccinia virus (strain Western Reserve) L1 Protein (E. coli, His)
Catalog Number: orb1976246
| Catalog Number | orb1976246 |
|---|---|
| Category | Proteins |
| Description | Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Vaccinia virus (strain Western Reserve) L1 Protein (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.8 kDa and the accession number is P07612. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 24.8 kDa (predicted) |
| UniProt ID | P07612 |
| Protein Sequence | GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG |
| Expression System | E. coli |
| Biological Origin | VACV |
| Biological Activity | Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Vaccinia virus (strain Western Reserve) L1 Protein (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 24.8 kDa and the accession number is P07612. |
| Expression Region | 2-183 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
