You have no items in your shopping cart.
Cart summary
Item 1 of 4
Item 1 of 4
USP2 Rabbit Polyclonal Antibody
Catalog Number: orb584295
| Catalog Number | orb584295 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to USP2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human USP2 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 68kDa |
| Target | USP2 |
| UniProt ID | O75604 |
| Protein Sequence | Synthetic peptide located within the following region: NEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK |
| NCBI | NP_004196 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | USP9, UBP41 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Rabbit Anti-USP2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Liver, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-USP2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Testis, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-USP2 Antibody, Catalog Number: orb584295, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic in perinuclear, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-USP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.
- Item 1 of 4
USP2 Antibody (C-term L523) [orb1931705]
IHC-P, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 4
- Item 1 of 2
USP2 Antibody [orb632433]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg - Item 1 of 2
- Item 1 of 1
