You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291767 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant USP14. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | USP14 (NP_005142, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ |
Tested applications | ELISA, IF, WB |
Clone Number | 6D6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_005142 |
Detection limit for recombinant GST tagged USP14 is approximately 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to USP14 on HeLa cell. [antibody concentration 20 ug/ml]
USP14 monoclonal antibody (M04), clone 6D6 Western Blot analysis of USP14 expression in HeLa.
USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in NIH/3T3.
USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in PC-12.
USP14 monoclonal antibody (M04), clone 6D6. Western Blot analysis of USP14 expression in Raw 264.7.
Western Blot analysis of USP14 expression in transfected 293T cell line by USP14 monoclonal antibody (M04), clone 6D6. Lane 1: USP14 transfected lysate (56.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa).