You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291981 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant USF2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | USF2 (NP_003358, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVS |
Tested applications | ELISA, IF, WB |
Clone Number | 6A9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003358 |
Detection limit for recombinant GST tagged USF2 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to USF2 on HeLa cell. [antibody concentration 10 ug/ml]
USF2 monoclonal antibody (M03), clone 6A9. Western Blot analysis of USF2 expression in different cell lines.
USF2 monoclonal antibody (M03), clone 6A9. Western Blot analysis of USF2 expression in Hela S3 NE.
USF2 monoclonal antibody (M03), clone 6A9. Western Blot analysis of USF2 expression in PC-12.
Western Blot detection against Immunogen (36.74 KDa).