You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
UPF3B Rabbit Polyclonal Antibody
Catalog Number: orb577859
| Catalog Number | orb577859 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to UPF3B |
| Target | UPF3B |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UPF3B |
| Protein Sequence | Synthetic peptide located within the following region: MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL |
| UniProt ID | Q9BZI7 |
| MW | 52kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | MRX62, MRX82, UPF3X, HUPF3B, MRXS14, RENT3B, UPF3B Read more... |
| Note | For research use only |
| NCBI | NP_075386 |
Rabbit Anti-UPF3B Antibody, Paraffin Embedded Tissue: Human Stomach, Cellular Data: Epithelial cells of fundic gland, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-UPF3B Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
- Item 1 of 2
- Item 1 of 2
UPF3B Antibody [orb632394]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg - Item 1 of 1
- Item 1 of 1
UPF3B Rabbit Polyclonal Antibody [orb577901]
WB
Canine, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 1
