You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334573 |
---|---|
Category | Antibodies |
Description | UNC5C Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, WB |
Predicted Reactivity | Gallus |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Flow Cytometry(Fixed), 1-3 μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 103146 MW |
UniProt ID | O95185 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Netrin receptor UNC5C;Protein unc-5 homolog 3;Prot Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of UNC5C using anti-UNC5C antibody.Lane 1:Rat Brain Tissue;2:Mouse Brain Tissue;3:HELA Cell.
Filter by Rating