UNC45B Rabbit Polyclonal Antibody

• Catalog Number: orb331180
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UNC45B
• Target: UNC45B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UNC45B
• Protein Sequence: Synthetic peptide located within the following region: TLVNCTNSYDVKEVIPELVQLAKFSKQHVPEEHPKDKKDFIDMRVKRLLK
• UniProt ID: Q8IWX7
• MW: 93kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CMYA4, MFM11, UNC45, CTRCT43, SMUNC45, UNC-45B
• Note: For research use only

Sample Type: 721_B whole cell lysates, Antibody dilution: 1.0 ug/ml.

Positive control (+): Mouse Heart (M-HE), Negative control (-): Mouse Kidney (M-KI), Antibody concentration: 1 ug/ml.