You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UHRF2 |
| Target | UHRF2 |
| Protein Sequence | Synthetic peptide located within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART |
| Molecular Weight | 90 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−NIRF/UHRF2 Rabbit Polyclonal Antibody [orb334639]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgUhrf2 Rabbit Polyclonal Antibody [orb575257]
WB
Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
100 μlNIRF Rabbit Polyclonal Antibody [orb340836]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~56 kDa.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 0.5 ug/ml.

Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 0.1 ug/ml.

Human Heart

WB Suggested Anti-UHRF2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.
Documents Download
Request a Document
Protocol Information
UHRF2 Rabbit Polyclonal Antibody (orb575258)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review










