UGCGL2 Rabbit Polyclonal Antibody

• Catalog Number: orb580546
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UGCGL2
• Target: UGGT2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UGCGL2
• Protein Sequence: Synthetic peptide located within the following region: KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR
• UniProt ID: Q9NYU1
• MW: 172kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: UGT2, HUGT2, UGCGL2
• Research Area: Cell Biology, Protein Biochemistry, Signal Transdu
• Note: For research use only
• NCBI: NP_064506
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-UGCGL2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. UGGT2 is supported by BioGPS gene expression data to be expressed in HepG2.