UGDH Rabbit Polyclonal Antibody

• Catalog Number: orb584948
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UGDH
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: UGDH
• UniProt ID: O60701
• Protein Sequence: Synthetic peptide located within the following region: VLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPK
• NCBI: NP_003350
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GDH, UGD, DEE84, EIEE84, UDPGDH, UDP-GlcDH
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-UGDH Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell. UGDH is supported by BioGPS gene expression data to be expressed in HepG2.