UCP1 Rabbit Polyclonal Antibody

• Catalog Number: orb585566
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UCP1
• Target: UCP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: AMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMD
• UniProt ID: P25874
• MW: 34kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: UCP, SLC25A7
• Research Area: Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_068605

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-UCP1 Antibody, Titration: 1.0 ug/ml, Positive Control: A549 Whole Cell. UCP1 is supported by BioGPS gene expression data to be expressed in A549.