UBE2L3 Rabbit Polyclonal Antibody

• Catalog Number: orb330275
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UBE2L3
• Target: UBE2L3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UBE2L3
• Protein Sequence: Synthetic peptide located within the following region: TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK
• UniProt ID: P68036
• MW: 75kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti E2-F1 antibody, anti L-UBC antibody, anti UBC
• Note: For research use only
• NCBI: NP_003338

Human Intestine

WB Suggested Anti-UBE2L3 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that UBE2L3 is expressed in Jurkat.