UBE2I UBC9 Antibody

• Catalog Number: orb443231
• Category: Antibodies
• Description: UBE2I UBC9 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human UBE2I UBC9 (NIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 18 kDa
• UniProt ID: P63279
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: SUMO-conjugating enzyme UBC9
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody.Lane 1:human placenta tissue; 2:human K562 cell; 3:human HepG2 cell; 4:rat brain tissue; 5:rat kidney tissue.

IF analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody.UBE2I/UBC9 was detected in immunocytochemical section of U20S cell.

IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody.UBE2I UBC9 was detected in paraffin-embedded section of human appendicitis tissue.

IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody.UBE2I UBC9 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody.UBE2I UBC9 was detected in paraffin-embedded section of human placenta tissue.

IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody.UBE2I UBC9 was detected in paraffin-embedded section of mouse brain tissue.

IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody.UBE2I UBC9 was detected in paraffin-embedded section of rat brain tissue.

IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody.UBE2I UBC9 was detected in paraffin-embedded section of rat lung tissue.

IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody.UBE2I UBC9 was detected in paraffin-embedded section of human gastric cancer tissue.

IHC analysis of UBE2I UBC9 using anti-UBE2I UBC9 antibody.UBE2I UBC9 was detected in paraffin-embedded section of human glioma tissue.

IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody.UBE2I/UBC9 was detected in paraffin-embedded section of human rectal cancer tissue.

IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody.UBE2I/UBC9 was detected in paraffin-embedded section of human thyroid cancer tissue.

IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody.UBE2I/UBC9 was detected in paraffin-embedded section of human tonsil tissue.

IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody.UBE2I/UBC9 was detected in paraffin-embedded section of mouse intestine tissue.

IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody.UBE2I/UBC9 was detected in paraffin-embedded section of mouse lung tissue.

IHC analysis of UBE2I/UBC9 using anti-UBE2I/UBC9 antibody.UBE2I/UBC9 was detected in paraffin-embedded section of rat intestine tissue.