You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977631 |
---|---|
Category | Proteins |
Description | UBE2D3 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 32.7 kDa and the accession number is P61077. |
Tag | N-6xHis-SUMO |
Protein Sequence | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
UniProt ID | P61077 |
MW | 32.7 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | E. coli |
Biological Origin | Human |
Expression Region | 1-147 aa |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |