UBE2D2 Rabbit Polyclonal Antibody

SKU: orb578680

Description

Rabbit polyclonal antibody to UBE2D2

Research Area

Cell Biology, Protein Biochemistry

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UBE2D2
• Target: UBE2D2
• Protein Sequence: Synthetic peptide located within the following region: SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE
• Molecular Weight: 17 kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

UBC4, PUBC1, UBCH4, UBC4/5, UBCH5B, E2(17)KB2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Human Lung

WB Suggested Anti-UBE2D2 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

UBE2D2

UniProt

P62837

RefSeq (Protein):NP_003330