You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291999 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant UBE2D1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | UBE2D1 (NP_003329, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWS |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 2C6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003329 |
Detection limit for recombinant GST tagged UBE2D1 is approximately 0.3 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to UBE2D1 on formalin-fixed paraffin-embedded human cervix cancer. [antibody concentration 1 ug/ml]
Western Blot analysis of UBE2D1 expression in transfected 293T cell line by UBE2D1 monoclonal antibody (M01), clone 2C6. Lane 1: UBE2D1 transfected lysate (16.6 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.08 KDa).