UBE2D1 monoclonal antibody (M01), clone 2C6

• Catalog Number: orb2291999
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant UBE2D1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2C6
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: UBE2D1 (NP_003329, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWS
• NCBI: NP_003329
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged UBE2D1 is approximately 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to UBE2D1 on formalin-fixed paraffin-embedded human cervix cancer. [antibody concentration 1 ug/ml]

Western Blot analysis of UBE2D1 expression in transfected 293T cell line by UBE2D1 monoclonal antibody (M01), clone 2C6. Lane 1: UBE2D1 transfected lysate (16.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.08 KDa).