You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291544 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human UBD protein. |
Clonality | Polyclonal |
Species/Host | Mouse |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | UBD (NP_006389.1, 1 a.a. ~ 165 a.a) full-length human protein. |
Protein Sequence | MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLASYCIGG |
Tested applications | IF, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_006389.1 |
Immunofluorescence of purified MaxPab antibody to UBD on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of UBD expression in transfected 293T cell line by UBD MaxPab polyclonal antibody. Lane 1: UBD transfected lysate(18.15 KDa). Lane 2: Non-transfected lysate.