UBD purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2291544
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human UBD protein.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: UBD (NP_006389.1, 1 a.a. ~ 165 a.a) full-length human protein.
• Protein Sequence: MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLASYCIGG
• Tested applications: IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_006389.1

Immunofluorescence of purified MaxPab antibody to UBD on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of UBD expression in transfected 293T cell line by UBD MaxPab polyclonal antibody. Lane 1: UBD transfected lysate(18.15 KDa). Lane 2: Non-transfected lysate.