Tyrosine Hydroxylase/TH Antibody

• Catalog Number: orb259626
• Category: Antibodies
• Description: Tyrosine Hydroxylase/TH Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 5μg/ml, Human Immunofluorescence, 5μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 58600 MW
• UniProt ID: P07101
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Tyrosine 3-monooxygenase;1.14.16.2;Tyrosine 3-hydr
• Note: For research use only
• Application notes: WB: The detection limit for Tyrosine Hydroxylase is approximately 0.1ng/lane under reducing conditions. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody.Lane 1:rat brain tissue;2:mouse brain tissue.

IF analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody. Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of mouse brian tissue.

IF analysis of Tyrosine Hydroxylase/TH using antiTyrosine Hydroxylase/TH antibody. Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of rat brian tissue.

IHC analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody. Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of mouse brain tissue.

IHC analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody. Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of rat brain tissue.