You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb259626 |
---|---|
Category | Antibodies |
Description | Tyrosine Hydroxylase/TH Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, IHC, WB |
Predicted Reactivity | Hamster |
Reactivity | Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 5μg/ml, Human Immunofluorescence, 5μg/ml, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 58600 MW |
UniProt ID | P07101 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Tyrosine 3-monooxygenase;1.14.16.2;Tyrosine 3-hydr Read more... |
Note | For research use only |
Application notes | WB: The detection limit for Tyrosine Hydroxylase is approximately 0.1ng/lane under reducing conditions. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody.Lane 1:rat brain tissue;2:mouse brain tissue.
IF analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody. Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of mouse brian tissue.
IF analysis of Tyrosine Hydroxylase/TH using antiTyrosine Hydroxylase/TH antibody. Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of rat brian tissue.
IHC analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody. Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of mouse brain tissue.
IHC analysis of Tyrosine Hydroxylase/TH using anti-Tyrosine Hydroxylase/TH antibody. Tyrosine Hydroxylase/TH was detected in a paraffin-embedded section of rat brain tissue.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating