You have no items in your shopping cart.
Cart summary
TXNDC17 Protein, Human, Recombinant (GST)
Catalog Number: orb1977723
| Catalog Number | orb1977723 |
|---|---|
| Category | Proteins |
| Description | Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide. |
| Tag | N-GST |
| Purity | 98.00% |
| Protein Sequence | MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED |
| UniProt ID | Q9BRA2 |
| MW | 40.9 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide. |
| Expression Region | 1-123 aa |
| Storage | -20°C |
| Note | For research use only |
