TXN Rabbit Polyclonal Antibody

SKU: orb333742

Description

TXN Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TXN. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Human TXN. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TXN
• Target: TXN
• Protein Sequence: Synthetic peptide located within the following region: NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT
• Molecular Weight: 11kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ADF antibody, anti SASP antibody, anti Thioredoxin antibody, anti TRDX antibody, anti TRX 1 antibody, anti Trx antibody, anti TRX1 antibody, anti TXN antibody, anti TXN protein antibody

Quick Database Links

Gene Symbol

TXN

UniProt

P10599

RefSeq (Protein):NP_003320