TXN Rabbit Polyclonal Antibody

SKU: orb333742

Description

Rabbit polyclonal antibody to TRX

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TXN
• Target: TXN
• Protein Sequence: Synthetic peptide located within the following region: NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT
• Molecular Weight: 11kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ADF antibody, anti SASP antibody, anti Thioredoxin antibody, anti TRDX antibody, anti TRX 1 antibody, anti Trx antibody, anti TRX1 antibody, anti TXN antibody, anti TXN protein antibody

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Sample Type: MCF7 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-TXN Antibody, Catalog Number: orb333742, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic near intercalated discs, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Quick Database Links

Gene Symbol

TXN

UniProt

P10599

RefSeq (Protein):NP_003320