TWIST1 monoclonal antibody (M13), clone 2G12

• Catalog Number: orb2292004
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant TWIST1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TWIST1 (NP_000465.1, 106 a.a. ~ 174 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: LQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMAS
• Tested applications: ELISA, IP, WB
• Clone Number: 2G12
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000465.1

Detection limit for recombinant GST tagged TWIST1 is 0.1 ng/ml as a capture antibody.

Immunoprecipitation of TWIST1 transfected lysate using anti-TWIST1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TWIST1 MaxPab rabbit polyclonal antibody.

Western Blot detection against Immunogen (33.22 KDa).