You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
TWIST1 monoclonal antibody (M13), clone 2G12
Catalog Number: orb2292004
| Catalog Number | orb2292004 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a full length recombinant TWIST1. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 2G12 |
| Tested applications | ELISA, IP, WB |
| Reactivity | Human |
| Isotype | IgG2a Kappa |
| Immunogen | TWIST1 (NP_000465.1, 106 a.a. ~ 174 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | LQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMAS |
| NCBI | NP_000465.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged TWIST1 is 0.1 ng/ml as a capture antibody.
Immunoprecipitation of TWIST1 transfected lysate using anti-TWIST1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TWIST1 MaxPab rabbit polyclonal antibody.
Western Blot detection against Immunogen (33.22 KDa).
