You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292005 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant TWIST1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH |
Tested applications | ELISA, IP, WB |
Clone Number | 3E11 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_000465 |
Immunoprecipitation of TWIST1 transfected lysate using anti-TWIST1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TWIST1 MaxPab rabbit polyclonal antibody.
TWIST1 monoclonal antibody (M01), clone 3E11. Western Blot analysis of TWIST1 expression in rat testis.
Western Blot analysis of TWIST1 expression in transfected 293T cell line by TWIST1 monoclonal antibody (M01), clone 3E11. Lane 1: TWIST1 transfected lysate (21 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of TWIST1 over-expressed 293 cell line, cotransfected with TWIST1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TWIST1 monoclonal antibody (M01), clone 3E11 (Cat # orb2292005). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (37.07 KDa).