TUT1 Rabbit Polyclonal Antibody

• Catalog Number: orb577176
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TUT1
• Target: TUT1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TUT1
• Protein Sequence: Synthetic peptide located within the following region: EGAGGGAGTRAGWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPAD
• UniProt ID: A8K995
• MW: 94kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PAPD2, RBM21, TENT1, URLC6, TUTase, STARPAP
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_073741

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): A549 Cell Lysate (N03), Antibody concentration: 3 ug/ml.

WB Suggested Anti-TUT1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Transfected 293T.