You have no items in your shopping cart.
Cart summary
TUBB3 Protein, Human, Recombinant (GST)
Catalog Number: orb1977656
| Catalog Number | orb1977656 |
|---|---|
| Category | Proteins |
| Description | TUBB3 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.1 kDa and the accession number is Q13509. |
| Tag | N-GST |
| Purity | 98.00% |
| Protein Sequence | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDI |
| UniProt ID | Q13509 |
| MW | 50.1 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | TUBB3 Protein, Human, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.1 kDa and the accession number is Q13509. |
| Expression Region | 1-210 aa |
| Storage | -20°C |
| Note | For research use only |
- Item 1 of 1
