TSPAN5 Rabbit Polyclonal Antibody

SKU: orb579834

Description

TSPAN5 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TSPAN5. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human TSPAN5. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPAN5
• Target: TSPAN5
• Protein Sequence: Synthetic peptide located within the following region: ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ
• Molecular Weight: 30 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Lyophilized from 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

NET4, NET-4, TM4SF9, TSPAN-5

Quick Database Links

Gene Symbol

TSPAN5

UniProt

P62079

RefSeq (Protein):NP_005714