TSPAN4 antibody

• Catalog Number: orb579278
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TSPAN4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPAN4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 26 kDa
• Target: TSPAN4
• UniProt ID: O14817
• Protein Sequence: Synthetic peptide located within the following region: YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW
• NCBI: NP_001020405
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NAG2, NAG-2, TM4SF7, TSPAN-4, TETRASPAN
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of Human Adult Liver using TSPAN4 antibody.

Western blot analysis of Human whole cell extracts using TSPAN4 antibody.